| Desktop | 93/100 | ✔ |
| Mobile | 75/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 45 KB | ✔ |
| Compression | 6 KB (-86.4%) | ✔ |
| Text/Html Ratio | 6550 / 46403 (bytes) = 14.12% | ✔ |
| Load Time | 1.17 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 10 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | Unknown | ✘ |
| Preferred Domain | No | ❗ |
| Robots.txt | No | ✘ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | No | ✔ | Images Without ALT | 34 / 36 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| garage | 70 | ✔ | ✔ | ✔ |
| door | 63 | ✔ | ✔ | ✔ |
| grayslake | 24 | ✔ | ✔ | ✔ |
| repair | 21 | ✘ | ✘ | ✔ |
| doors | 12 | ✘ | ✘ | ✔ |
| installation | 11 | ✘ | ✘ | ✔ |
| opener | 10 | ✘ | ✘ | ✔ |
| spring | 9 | ✘ | ✘ | ✔ |
| lift | 8 | ✘ | ✘ | ✔ |
| service | 8 | ✘ | ✔ | ✔ |
| complete | 6 | ✘ | ✘ | ✔ |
| will | 6 | ✘ | ✘ | ✘ |
| replacement | 6 | ✘ | ✘ | ✘ |
| master | 6 | ✘ | ✘ | ✔ |
| installations | 5 | ✘ | ✘ | ✔ |
|
With 1.17 seconds in page load, 45 KB of page size and all other reports below, the masterliftservicegrayslake.com has a SEO score of 48 out of 100 |
| Title | Garage Door Grayslake 847-556-8673 | Garage Door Grayslake IL | Garage Door in Grayslake |
| Description | Garage Door Grayslake provides 24 Garage Door service to all of Grayslake IL. We have proudly been serving Grayslake for over 20 years. Call Garage Door Grayslake 847-556-8673 24 hours 7 days a week |
| Keyword | Garage Door Grayslake,Garage Door in Grayslake ,Garage Door service in Grayslake ,emergency Garage Door Grayslake ,24 hour Garage Door Grayslake , Garage Door Grayslake IL |
| Age | 0 Years, 3 Days |
| Created | 26th-May-2020 |
| Updated | 26th-May-2020 |
| Expiry | 26th-May-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain Name: masterliftservicegrayslake.com Registry Domain ID: 2530569855_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-05-26T11:47:07Z Creation Date: 2020-05-26T11:47:06Z Registrar Registration Expiration Date: 2021-05-26T11:47:06Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Registrant State/Province: Illinois Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=masterliftservicegrayslake.com Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=masterliftservicegrayslake.com Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=masterliftservicegrayslake.com Name Server: NS21.DOMAINCONTROL.COM Name Server: NS22.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-05-29T07:00:00Z |
| Server IP | 107.180.51.3 |
| Server Location | United States |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| masterliftservicegrayslake.net | Available |
| masterliftservicegrayslake.org | Available |
| masterliftservicegrayslake.biz | Already Registered |
| masterliftservicegrayslake.io | Already Registered |
| masterliftservicegrayslake.info | Available |
| Domains (TLD) | Status |
|---|---|
| nasterliftservicegrayslake.com | Available |
| hasterliftservicegrayslake.com | Available |
| jasterliftservicegrayslake.com | Available |
| kasterliftservicegrayslake.com | Available |
| lasterliftservicegrayslake.com | Available |
| Frclw.com |
| Pawonmimih.com |
| Thejdubs.com |
| L2khalifa.club |
| Globonano.com |
| Myeducationalmentor.com |
| The-magnet-wall.com |
| Saveursdesaigon.com |
| Chef-kerlin.com |
| Browardbankruptcylaw.com |